mutationassessor.org
functional impact of protein mutations
release   3  
cBio@MSKCC

papers | about | privacy | changes | how it works | web API

BLAST mapping of all PDB structures to region EGFR_HUMAN/712-968
Only mappings with position of current variant G719S shown

PDB e-value length identity resolution ligand small.mol
name
ligand
protein ID
title header
1 1m14:A 0 257 100.0% 2.6 tyrosine kinase domain from epidermal growth factor receptor transferase
2 1m17:A 0 257 100.0% 2.6 epidermal growth factor receptor tyrosine kinase domain with 4-anilinoquinazoline inhibitor erlotinib transferase
3 2itw:A 0 257 100.0% 2.88 sm.mol STU crystal structure of egfr kinase domain in complex with afn941 transferase
4 2j6m:A 0 257 100.0% 3.1 crystal structure of egfr kinase domain in complex with aee788 transferase
5 3w32:A 0 257 100.0% 1.8 sm.mol W32 egfr kinase domain complexed with compound 20a transferase/transferase inhibitor
6 4jq7:A 0 257 100.0% 2.73 sm.mol KJQ crystal structure of egfr kinase domain in complex with compo transferase/transferase inhibitor
7 4jq8:A 0 257 100.0% 2.83 sm.mol KJ8 crystal structure of egfr kinase domain in complex with compo transferase/transferase inhibitor
8 4jr3:A 0 257 100.0% 2.7 sm.mol KJR crystal structure of egfr kinase domain in complex with compo transferase/transferase inhibitor
9 4li5:A 0 257 100.0% 2.64 sm.mol 1WY egfr-k in complex with n-[3-[[5-chloro-4-(1h-indol-3-yl)pyrim yl]amino]-4-methoxy-phenyl] prop-2-enamide transferase/transferase inhibitor
10 4lrm:E 0 257 100.0% 3.53 sm.mol YUN egfr d770_n771insnpg in complex with pd168393 transferase/transferase inhibitor
11 4lrm:A 0 257 100.0% 3.53 sm.mol YUN egfr d770_n771insnpg in complex with pd168393 transferase/transferase inhibitor
12 4lrm:C 0 257 100.0% 3.53 sm.mol YUN egfr d770_n771insnpg in complex with pd168393 transferase/transferase inhibitor
13 4lrm:B 0 257 100.0% 3.53 egfr d770_n771insnpg in complex with pd168393 transferase/transferase inhibitor
14 4lrm:D 0 257 100.0% 3.53 sm.mol YUN egfr d770_n771insnpg in complex with pd168393 transferase/transferase inhibitor
15 2itp:A 0 257 99.6% 2.74 crystal structure of egfr kinase domain g719s mutation in complex with aee788 transferase
16 2itq:A 0 257 99.6% 2.68 sm.mol STU crystal structure of egfr kinase domain g719s mutation in complex with afn941 transferase
17 2j5e:A 0 257 99.6% 3.1 crystal structure of egfr kinase domain in complex with an irreversible inhibitor 13-jab transferase
18 2jit:B 0 257 99.6% 3.1 crystal structure of egfr kinase domain t790m mutation transferase
19 2jit:A 0 257 99.6% 3.1 crystal structure of egfr kinase domain t790m mutation transferase
20 2jiu:A 0 257 99.6% 3.05 crystal structure of egfr kinase domain t790m mutation in complex with aee788 transferase
21 2jiu:B 0 257 99.6% 3.05 crystal structure of egfr kinase domain t790m mutation in complex with aee788 transferase
22 3ika:A 0 257 99.6% 2.9 sm.mol 0UN crystal structure of egfr 696-1022 t790m mutant covalently binding to wz4002 transferase
23 4g5p:A 0 257 99.6% 3.17 crystal structure of egfr kinase t790m in complex with bibw29 transferase/transferase inhibitor
24 3w2o:A 0 257 99.2% 2.35 sm.mol 03P egfr kinase domain t790m/l858r mutant with tak-285 transferase/transferase inhibitor
25 3w2p:A 0 257 99.2% 2.05 egfr kinase domain t790m/l858r mutant with compound 2 transferase/transferase inhibitor
26 3w2q:A 0 257 99.2% 2.2 egfr kinase domain t790m/l858r mutant with hki-272 transferase/transferase inhibitor
27 4i20:A 0 257 99.2% 3.34 crystal structure of monomeric (v948r) primary oncogenic muta egfr kinase domain transferase
28 4i21:B 0 257 99.2% 3.37 crystal structure of l858r + t790m egfr kinase domain in comp mig6 peptide transferase/transferase inhibitor
29 4i21:A 0 257 99.2% 3.37 crystal structure of l858r + t790m egfr kinase domain in comp mig6 peptide transferase/transferase inhibitor
30 2gs2:A 0 257 98.8% 2.8 crystal structure of the active egfr kinase domain transferase
31 2gs6:A 0 257 98.8% 2.6 crystal structure of the active egfr kinase domain in complex with an atp analog-peptide conjugate transferase
32 3ika:B 0 257 98.8% 2.9 crystal structure of egfr 696-1022 t790m mutant covalently binding to wz4002 transferase
33 4i1z:A 0 257 98.8% 3 crystal structure of the monomeric (v948r) form of the gefitinib/erlotinib resistant egfr kinase domain l858r+t79 transferase
34 4jrv:A 0 257 98.8% 2.8 sm.mol KJV crystal structure of egfr kinase domain in complex with compo transferase/transferase inhibitor
35 2gs7:B 0 257 98.4% 2.6 sm.mol ANP crystal structure of the inactive egfr kinase domain in complex with amp-pnp transferase
36 2itx:A 0 257 98.4% 2.98 sm.mol ANP crystal structure of egfr kinase domain in complex with amp- pnp transferase
37 2gs7:A 0 257 98.1% 2.6 sm.mol ANP crystal structure of the inactive egfr kinase domain in complex with amp-pnp transferase
38 2rf9:A 0 257 98.1% 3.5 crystal structure of the complex between the egfr kinase domain and a mig6 peptide transferase
39 3vjo:A 0 257 98.1% 2.64 sm.mol ANP crystal structure of the wild-type egfr kinase domain in comp amppnp. transferase
40 4hjo:A 0 257 98.1% 2.75 crystal structure of the inactive egfr tyrosine kinase domain erlotinib transferase/transferase inhibitor
41 4i23:A 0 257 98.1% 2.8 crystal structure of the wild-type egfr kinase domain in comp dacomitinib (soaked) transferase
42 2eb2:A 0 257 97.7% 2.5 crystal structure of mutated egfr kinase domain (g719s) transferase
43 3vjn:A 0 257 97.7% 2.34 sm.mol ANP crystal structure of the mutated egfr kinase domain (g719s/t7 complex with amppnp. transferase
44 2j5f:A 0 257 96.9% 3 crystal structure of egfr kinase domain in complex with an irreversible inhibitor 34-jab transferase
45 2rfe:A 0 257 96.5% 2.9 crystal structure of the complex between the egfr kinase domain and a mig6 peptide transferase
46 4g5p:B 0 257 96.5% 3.17 crystal structure of egfr kinase t790m in complex with bibw29 transferase/transferase inhibitor
47 2itn:A 0 257 96.1% 2.47 sm.mol ANP crystal structure of egfr kinase domain g719s mutation in complex with amp-pnp transferase
48 2ito:A 0 257 96.1% 3.25 sm.mol IRE crystal structure of egfr kinase domain g719s mutation in complex with iressa transferase
49 2itt:A 0 257 96.1% 2.73 crystal structure of egfr kinase domain l858r mutation in complex with aee788 transferase
50 2itv:A 0 257 96.1% 2.47 crystal structure of egfr kinase domain l858r mutation in complex with amp-pnp transferase
51 2ity:A 0 257 96.1% 3.42 sm.mol IRE crystal structure of egfr kinase domain in complex with iressa transferase
52 3ug1:A 0 257 96.1% 2.75 crystal structure of the mutated egfr kinase domain (g719s/t7 the apo form transferase
53 3ug2:A 0 257 96.1% 2.5 sm.mol IRE crystal structure of the mutated egfr kinase domain (g719s/t7 complex with gefitinib transferase/transferase inhibitor
54 2itu:A 0 257 95.7% 2.8 sm.mol STU crystal structure of egfr kinase domain l858r mutation in complex with afn941 transferase
55 2itz:A 0 257 95.7% 2.72 crystal structure of egfr kinase domain l858r mutation in complex with iressa transferase
56 4lqm:A 0 257 95.7% 2.5 egfr l858r in complex with pd168393 transferase/transferase inhibitor
57 2rfe:B 0 257 95.3% 2.9 crystal structure of the complex between the egfr kinase domain and a mig6 peptide transferase
58 3w2s:A 0 257 95.3% 1.9 egfr kinase domain with compound4 transferase/transferase inhibitor
59 4i24:B 0 257 95.3% 1.8 structure of t790m egfr kinase domain co-crystallized with da transferase
60 2rfd:B 0 257 94.9% 3.6 crystal structure of the complex between the egfr kinase domain and a mig6 peptide transferase
61 2jiv:B 0 257 94.6% 3.5 sm.mol CY7 crystal structure of egfr kinase domain t790m mutation in compex with hki-272 transferase
62 3gt8:C 0 257 94.6% 2.96 sm.mol ANP crystal structure of the inactive egfr kinase domain in complex with amp-pnp transferase
63 4g5j:A 0 257 94.6% 2.8 crystal structure of egfr kinase in complex with bibw2992 transferase/transferase inhibitor
64 2rfd:A 0 257 94.2% 3.6 crystal structure of the complex between the egfr kinase domain and a mig6 peptide transferase
65 2rfe:D 0 257 94.2% 2.9 crystal structure of the complex between the egfr kinase domain and a mig6 peptide transferase
66 4ll0:A 0 257 94.2% 4 egfr l858r/t790m in complex with pd168393 transferase/transferase inhibitor
67 1xkk:A 0 257 93.8% 2.4 sm.mol FMM egfr kinase domain complexed with a quinazoline inhibitor- gw572016 transferase
68 2eb3:A 0 257 93.8% 2.84 sm.mol ANP crystal structure of mutated egfr kinase domain (l858r) in complex with amppnp transferase
69 2rf9:B 0 257 93.8% 3.5 crystal structure of the complex between the egfr kinase domain and a mig6 peptide transferase
70 3gt8:D 0 257 93.8% 2.96 sm.mol ANP crystal structure of the inactive egfr kinase domain in complex with amp-pnp transferase
71 3gt8:B 0 257 93.8% 2.96 sm.mol ANP crystal structure of the inactive egfr kinase domain in complex with amp-pnp transferase
72 3gt8:A 0 257 93.8% 2.96 sm.mol ANP crystal structure of the inactive egfr kinase domain in complex with amp-pnp transferase
73 3w2r:A 0 257 93.8% 2.05 egfr kinase domain t790m/l858r mutant with compound 4 transferase/transferase inhibitor
74 4ll0:B 0 257 93.8% 4 egfr l858r/t790m in complex with pd168393 transferase/transferase inhibitor
75 2jiv:A 0 257 93.4% 3.5 sm.mol CY7 crystal structure of egfr kinase domain t790m mutation in compex with hki-272 transferase
76 2rgp:A 0 257 93.4% 2 sm.mol HYZ structure of egfr in complex with hydrazone, a potent dual inhibitor transferase
77 3lzb:A 0 257 93.4% 2.7 protein EGFR_HUMAN egfr kinase domain complexed with an imidazo[2,1-b]thiazole i transferase/transferase inhibitor
78 3lzb:B 0 257 93.4% 2.7 egfr kinase domain complexed with an imidazo[2,1-b]thiazole i transferase/transferase inhibitor
79 3w33:A 0 257 93.4% 1.7 sm.mol W19 egfr kinase domain complexed with compound 19b transferase/transferase inhibitor
80 3bel:A 0 257 93.0% 2.3 x-ray structure of egfr in complex with oxime inhibitor transferase
81 3poz:A 0 257 93.0% 1.5 sm.mol 03P egfr kinase domain complexed with tak-285 transferase/transferase inhibitor
82 2rfe:C 0 257 91.8% 2.9 crystal structure of the complex between the egfr kinase domain and a mig6 peptide transferase
83 3lzb:D 0 257 91.8% 2.7 sm.mol ITI egfr kinase domain complexed with an imidazo[2,1-b]thiazole i transferase/transferase inhibitor
84 4i22:A 0 257 91.8% 1.71 sm.mol IRE structure of the monomeric (v948r)gefitinib/erlotinib resista mutant (l858r+t790m) egfr kinase domain co-crystallized wi gefitinib transferase
85 4i24:A 0 257 91.8% 1.8 structure of t790m egfr kinase domain co-crystallized with da transferase
86 3lzb:C 0 257 91.4% 2.7 egfr kinase domain complexed with an imidazo[2,1-b]thiazole i transferase/transferase inhibitor
87 3gop:A 0 257 88.3% 2.8 crystal structure of the egf receptor juxtamembrane and kinase domains transferase
88 3pp0:A 0 257 81.3% 2.25 crystal structure of the kinase domain of human her2 (erbb2). transferase/transferase inhibitor
89 3pp0:B 0 257 81.3% 2.25 crystal structure of the kinase domain of human her2 (erbb2). transferase/transferase inhibitor
90 3bce:C 0 257 78.2% 2.5 crystal structure of the erbb4 kinase transferase
91 3bce:A 0 257 77.8% 2.5 crystal structure of the erbb4 kinase transferase
92 3bce:B 0 257 77.4% 2.5 crystal structure of the erbb4 kinase transferase
93 2r4b:A 0 257 77.0% 2.4 erbb4 kinase domain complexed with a thienopyrimidine inhibitor transferase
94 2r4b:B 0 257 77.0% 2.4 erbb4 kinase domain complexed with a thienopyrimidine inhibitor transferase
95 3rcd:A 0 257 76.3% 3.21 sm.mol 03P her2 kinase domain complexed with tak-285 transferase/transferase inhibitor
96 3rcd:C 0 257 76.3% 3.21 sm.mol 03P her2 kinase domain complexed with tak-285 transferase/transferase inhibitor
97 3rcd:B 0 257 75.9% 3.21 her2 kinase domain complexed with tak-285 transferase/transferase inhibitor
98 3rcd:D 0 257 75.9% 3.21 her2 kinase domain complexed with tak-285 transferase/transferase inhibitor
99 3bbt:B 0 257 75.1% 2.8 crystal structure of the erbb4 kinase in complex with lapatinib transferase
100 3bbw:A 0 257 75.1% 4 crystal structure of the erbb4 kinase in its inactive conformation transferase
101 3bbw:B 0 257 75.1% 4 crystal structure of the erbb4 kinase in its inactive conformation transferase
102 3bbt:D 0 257 73.5% 2.8 crystal structure of the erbb4 kinase in complex with lapatinib transferase
103 3lmg:A 0 257 58.8% 2.8 protein ERBB3_HUMAN crystal structure of the erbb3 kinase domain in complex with transferase
104 3lmg:A 0 257 58.8% 2.8 sm.mol ANP crystal structure of the erbb3 kinase domain in complex with transferase
105 3kex:B 0 257 58.4% 2.8 sm.mol ANP crystal structure of the catalytically inactive kinase domain of the human epidermal growth factor receptor 3 (her3) transferase
106 3kex:A 0 257 58.4% 2.8 sm.mol ANP crystal structure of the catalytically inactive kinase domain of the human epidermal growth factor receptor 3 (her3) transferase
107 4otw:A 0 257 58.4% 2.51 sm.mol DB8 her3 pseudokinase domain bound to bosutinib transferase/transferase inhibitor
108 3lmg:B 0 257 58.0% 2.8 protein ERBB3_HUMAN crystal structure of the erbb3 kinase domain in complex with transferase
109 3lmg:B 0 257 58.0% 2.8 sm.mol ANP crystal structure of the erbb3 kinase domain in complex with transferase
110 3hmi:A 0 246 42.7% 1.65 sm.mol DKI the crystal structure of human abl2 in complex with 5-amino- 3-{[4-(aminosulfonyl)phenyl]amino}-n-(2,6-difluorophenyl)- 1h-1,2,4-triazole-1-carbothioamide transferase
111 3vf9:A 0 246 42.7% 2.3 crystal structure of spleen tyrosine kinase syk catalytic dom thienopyrazolylindole inhibitor 027 transferase/transferase inhibitor
112 4f4p:A 0 246 42.7% 2.37 sm.mol 0SB syk in complex with ligand lasw836 transferase/transferase inhibitor
113 1xba:A 0 246 42.3% 2 crystal structure of apo syk tyrosine kinase domain transferase
114 3emg:A 0 246 42.3% 2.6 sm.mol 685 discovery and sar of novel 4-thiazolyl-2- phenylaminopyrimidines as potent inhibitors of spleen tyrosine kinase (syk) transferase
115 3vf8:A 0 246 42.3% 2.08 crystal structure of spleen tyrosine kinase syk catalytic dom pyrazolylbenzimidazole inhibitor 416 transferase/transferase inhibitor
116 2xyn:C 0 246 41.9% 2.81 sm.mol VX6 human abl2 in complex with aurora kinase inhibitor vx-680 transferase
117 2xyn:A 0 246 41.9% 2.81 sm.mol VX6 human abl2 in complex with aurora kinase inhibitor vx-680 transferase
118 2xyn:B 0 246 41.9% 2.81 protein ABL2_HUMAN human abl2 in complex with aurora kinase inhibitor vx-680 transferase
119 2xyn:B 0 246 41.9% 2.81 sm.mol VX6 human abl2 in complex with aurora kinase inhibitor vx-680 transferase
120 4fl2:A 0 246 41.9% 2.19 sm.mol ANP structural and biophysical characterization of the syk activa switch transferase
121 4gfg:A 0 246 41.9% 2.35 sm.mol 0XF crystal structure of spleen tyrosine kinase complexed with r9 transferase/transferase inhibitor
122 4px6:A 0 246 41.9% 1.6 syk catalytic domain in complex with a potent pyridopyrimidin inhibitor transferase/transferase inhibitor
123 1u4d:B 0 256 41.8% 2.1 structure of the ack1 kinase domain bound to debromohymenialdisine transferase
124 3eqp:A 0 256 41.8% 2.3 sm.mol T95 crystal structure of ack1 with compound t95 transferase
125 3eqp:B 0 256 41.8% 2.3 sm.mol T95 crystal structure of ack1 with compound t95 transferase
126 3eqr:A 0 256 41.8% 2 sm.mol T74 crystal structure of ack1 with compound t74 transferase
127 4id7:A 0 256 41.8% 3 sm.mol 1G0 ack1 kinase in complex with the inhibitor cis-3-[8-amino-1-(4 phenoxyphenyl)imidazo[1,5-a]pyrazin-3-yl]cyclobutanol transferase/transferase inhibitor
128 2wd1:A 0 250 41.6% 2 sm.mol ZZY human c-met kinase in complex with azaindole inhibitor transferase
129 4dfn:A 0 246 41.1% 2.48 sm.mol 0K1 crystal structure of spleen tyrosine kinase complexed with an adamantylpyrazine inhibitor transferase/transferase inhibitor
130 4fl1:A 0 246 41.1% 1.79 sm.mol ANP structural and biophysical characterization of the syk activa switch transferase
131 1fpu:A 0 251 41.0% 2.4 crystal structure of abl kinase domain in complex with a small molecule inhibitor transferase
132 1iep:A 0 251 41.0% 2.1 crystal structure of the c-abl kinase domain in complex with sti-571. transferase
133 1iep:B 0 251 41.0% 2.1 crystal structure of the c-abl kinase domain in complex with sti-571. transferase
134 1m52:A 0 251 41.0% 2.6 sm.mol P17 crystal structure of the c-abl kinase domain in complex with pd173955 transferase
135 1m52:B 0 251 41.0% 2.6 sm.mol P17 crystal structure of the c-abl kinase domain in complex with pd173955 transferase
136 1opj:A 0 251 41.0% 1.75 structural basis for the auto-inhibition of c-abl tyrosine kinase transferase
137 1opj:B 0 251 41.0% 1.75 structural basis for the auto-inhibition of c-abl tyrosine kinase transferase
138 2g1t:A 0 251 41.0% 1.8 peptide a src-like inactive conformation in the abl tyrosine kinase domain transferase
139 2g1t:A 0 251 41.0% 1.8 sm.mol 112 a src-like inactive conformation in the abl tyrosine kinase domain transferase
140 2g1t:C 0 251 41.0% 1.8 peptide a src-like inactive conformation in the abl tyrosine kinase domain transferase
141 2g1t:C 0 251 41.0% 1.8 sm.mol 112 a src-like inactive conformation in the abl tyrosine kinase domain transferase
142 2g1t:B 0 251 41.0% 1.8 peptide a src-like inactive conformation in the abl tyrosine kinase domain transferase
143 2g1t:B 0 251 41.0% 1.8 sm.mol 112 a src-like inactive conformation in the abl tyrosine kinase domain transferase
144 2g1t:D 0 251 41.0% 1.8 peptide a src-like inactive conformation in the abl tyrosine kinase domain transferase
145 2g1t:D 0 251 41.0% 1.8 sm.mol 112 a src-like inactive conformation in the abl tyrosine kinase domain transferase
146 2gqg:B 0 251 41.0% 2.4 x-ray crystal structure of dasatinib (bms-354825) bound to activated abl kinase domain transferase
147 2gqg:A 0 251 41.0% 2.4 sm.mol 1N1 x-ray crystal structure of dasatinib (bms-354825) bound to activated abl kinase domain transferase
148 2hiw:A 0 251 41.0% 2.2 crystal structure of inactive conformation abl kinase catalytic domain complexed with type ii inhibitor transferase
149 2hiw:B 0 251 41.0% 2.2 crystal structure of inactive conformation abl kinase catalytic domain complexed with type ii inhibitor transferase
150 2hz0:A 0 251 41.0% 2.1 abl kinase domain in complex with nvp-aeg082 transferase
151 2hzi:A 0 251 41.0% 1.7 sm.mol JIN abl kinase domain in complex with pd180970 transferase
152 3kfa:A 0 251 41.0% 1.22 structural analysis of dfg-in and dfg-out dual src-abl inhibitors sharing a common vinyl purine template transferase
153 3kfa:B 0 251 41.0% 1.22 structural analysis of dfg-in and dfg-out dual src-abl inhibitors sharing a common vinyl purine template transferase
154 3qri:A 0 251 41.0% 2.1 the crystal structure of human abl1 kinase domain in complex 2036 transferase/transferase inhibitor
155 3qrk:A 0 251 41.0% 2.3 the crystal structure of human abl1 kinase domain in complex 987 transferase/transferase inhibitor
156 3ue4:A 0 251 41.0% 2.42 structural and spectroscopic analysis of the kinase inhibitor bosutinib binding to the abl tyrosine kinase domain transferase/transferase inhibitor
157 2g2f:A 0 247 40.9% 2.7 peptide a src-like inactive conformation in the abl tyrosine kinase domain transferase
158 2g2f:A 0 247 40.9% 2.7 sm.mol 112 a src-like inactive conformation in the abl tyrosine kinase domain transferase
159 3dk3:B 0 247 40.9% 2.02 sm.mol SX7 crystal structure of mutant abl kinase domain in complex with small molecule fragment transferase
160 3qrj:B 0 247 40.9% 1.82 the crystal structure of human abl1 kinase domain t315i mutan complex with dcc-2036 transferase/transferase inhibitor
161 4deh:A 0 250 40.8% 2 crystal structure of c-met in complex with triazolopyridinone inhibitor 3 transferase/transferase inhibitor
162 1xbb:A 0 246 40.7% 1.57 sm.mol STI crystal structure of the syk tyrosine kinase domain with gleevec transferase
163 1xbc:A 0 246 40.7% 2 sm.mol STU crystal structure of the syk tyrosine kinase domain with staurosporin transferase
164 3fqe:A 0 246 40.7% 2.5 sm.mol P5C crystal structure of spleen tyrosine kinase complexed with ym193306 transferase
165 3fqs:A 0 246 40.7% 2.1 sm.mol 585 crystal structure of spleen tyrosine kinase complexed with r406 transferase
166 3srv:B 0 246 40.7% 1.95 sm.mol S19 crystal structure of spleen tyrosine kinase (syk) in complex diaminopyrimidine carboxamide inhibitor transferase/transferase inhibitor
167 4puz:A 0 246 40.7% 2.08 sm.mol CG9 crystal structure of spleen tyrosine kinase (syk) in complex 9973 transferase/transferase inhibitor
168 4puz:B 0 246 40.7% 2.08 sm.mol CG9 crystal structure of spleen tyrosine kinase (syk) in complex 9973 transferase/transferase inhibitor
169 1opk:A 0 251 40.6% 1.8 sm.mol P16 structural basis for the auto-inhibition of c-abl tyrosine kinase transferase
170 1opl:B 0 251 40.6% 3.42 sm.mol P16 structural basis for the auto-inhibition of c-abl tyrosine kinase transferase
171 1opl:A 0 251 40.6% 3.42 sm.mol P16 structural basis for the auto-inhibition of c-abl tyrosine kinase transferase
172 2f4j:A 0 251 40.6% 1.91 sm.mol VX6 structure of the kinase domain of an imatinib-resistant abl mutant in complex with the aurora kinase inhibitor vx-680 transferase
173 2fo0:A 0 251 40.6% 2.27 sm.mol P16 organization of the sh3-sh2 unit in active and inactive forms of the c-abl tyrosine kinase transferase
174 2g2h:A 0 251 40.6% 2 sm.mol P16 a src-like inactive conformation in the abl tyrosine kinase domain transferase
175 2g2h:B 0 251 40.6% 2 sm.mol P16 a src-like inactive conformation in the abl tyrosine kinase domain transferase
176 2hyy:B 0 251 40.6% 2.4 human abl kinase domain in complex with imatinib (sti571, glivec) transferase
177 2hyy:D 0 251 40.6% 2.4 human abl kinase domain in complex with imatinib (sti571, glivec) transferase
178 2hzi:B 0 251 40.6% 1.7 sm.mol JIN abl kinase domain in complex with pd180970 transferase
179 2qoh:A 0 251 40.6% 1.95 sm.mol P3Y crystal structure of abl kinase bound with ppy-a transferase
180 3cs9:A 0 251 40.6% 2.21 human abl kinase in complex with nilotinib transferase
181 3cs9:D 0 251 40.6% 2.21 human abl kinase in complex with nilotinib transferase
182 3dk3:A 0 251 40.6% 2.02 sm.mol SX7 crystal structure of mutant abl kinase domain in complex with small molecule fragment transferase
183 3ik3:B 0 251 40.6% 1.9 ap24534, a pan-bcr-abl inhibitor for chronic myeloid leukemia, potently inhibits the t315i mutant and overcomes mutation-based resistance transferase
184 3k5v:A 0 251 40.6% 1.74 structure of abl kinase in complex with imatinib and gnf-2 transferase
185 3oy3:A 0 251 40.6% 1.95 crystal structure of abl t315i mutant kinase domain bound wit out inhibitor ap24589 transferase/transferase inhibitor
186 3oy3:B 0 251 40.6% 1.95 crystal structure of abl t315i mutant kinase domain bound wit out inhibitor ap24589 transferase/transferase inhibitor
187 3pyy:A 0 251 40.6% 1.85 discovery and characterization of a cell-permeable, small-mol abl kinase activator that binds to the myristoyl binding s transferase
188 2ivs:A 0 249 40.6% 2 sm.mol ACK crystal structure of non-phosphorylated ret tyrosine kinase domain transferase
189 2ivv:A 0 249 40.6% 2.25 crystal structure of phosphorylated ret tyrosine kinase domain complexed with the inhibitor pp1 transferase
190 2x2m:A 0 252 40.5% 2.5 crystal structure of phosphorylated ret tyrosine kinase domain with inhibitor transferase
191 4fyo:A 0 246 40.2% 1.4 sm.mol 0VF crystal structure of spleen tyrosine kinase complexed with n- [7-(3,4-dimethoxy-phenylamino)-thiazolo[5,4-d]pyrimidin-5- pyrrolidin-3-yl}-terephthalamic acid transferase/transferase inhibitor
192 4i0s:A 0 246 40.2% 1.98 sm.mol 1B5 crystal structure of spleen tyrosine kinase complexed with 2- chloro-1-methyl-1h-indazol-3-yl)-5h-pyrrolo[2,3-b]pyrazine carboxylic acid isopropylamide transferase/transferase inhibitor
193 2hyy:A 0 251 40.2% 2.4 human abl kinase domain in complex with imatinib (sti571, glivec) transferase
194 2qoh:B 0 251 40.2% 1.95 sm.mol P3Y crystal structure of abl kinase bound with ppy-a transferase
195 2z60:A 0 251 40.2% 1.95 sm.mol P3Y crystal structure of the t315i mutant of abl kinase bound with ppy-a transferase
196 3k5v:B 0 251 40.2% 1.74 structure of abl kinase in complex with imatinib and gnf-2 transferase
197 3kf4:A 0 251 40.2% 1.9 sm.mol B90 structural analysis of dfg-in and dfg-out dual src-abl inhibitors sharing a common vinyl purine template transferase
198 3kf4:B 0 251 40.2% 1.9 sm.mol B90 structural analysis of dfg-in and dfg-out dual src-abl inhibitors sharing a common vinyl purine template transferase
199 3eqr:B 0 256 40.2% 2 sm.mol T74 crystal structure of ack1 with compound t74 transferase
200 4ewh:A 0 256 40.2% 2.5 sm.mol T77 co-crystal structure of ack1 with inhibitor transferase/transferase inhibitor
201 4ewh:B 0 256 40.2% 2.5 sm.mol T77 co-crystal structure of ack1 with inhibitor transferase/transferase inhibitor
202 2ivt:A 0 249 40.2% 2.6 sm.mol AMP crystal structure of phosphorylated ret tyrosine kinase domain transferase
203 2ivu:A 0 249 40.2% 2.5 sm.mol ZD6 crystal structure of phosphorylated ret tyrosine kinase domain complexed with the inhibitor zd6474 transferase
204 2x2k:A 0 249 40.2% 2.6 crystal structure of phosphorylated ret tyrosine kinase domain with inhibitor transferase
205 2x2l:A 0 249 40.2% 2 crystal structure of phosphorylated ret tyrosine kinase domain with inhibitor transferase
206 4ckj:A 0 249 40.2% 1.65 sm.mol ADN crystal structure of ret tyrosine kinase domain bound to aden transferase
207 1u54:B 0 255 40.0% 2.8 crystal structures of the phosphorylated and unphosphorylated kinase domains of the cdc42-associated tyrosine kinase ack1 bound to amp-pcp transferase
208 2ivs:B 0 249 39.8% 2 sm.mol ACK crystal structure of non-phosphorylated ret tyrosine kinase domain transferase
209 4cki:A 0 249 39.8% 2.12 sm.mol ADN crystal structure of oncogenic ret tyrosine kinase m918t boun adenosine transferase
210 1u4d:A 0 256 39.5% 2.1 structure of the ack1 kinase domain bound to debromohymenialdisine transferase
211 4hzs:A 0 256 39.5% 3.23 crystal structure of ack1 kinase domain with c-terminal sh3 d transferase
212 4hzs:B 0 256 39.5% 3.23 crystal structure of ack1 kinase domain with c-terminal sh3 d transferase
213 4hzs:C 0 256 39.5% 3.23 crystal structure of ack1 kinase domain with c-terminal sh3 d transferase
214 4hzs:D 0 256 39.5% 3.23 crystal structure of ack1 kinase domain with c-terminal sh3 d transferase
215 2j0l:A 0 249 39.4% 2.3 sm.mol ANP crystal structure of a the active conformation of the kinase domain of focal adhesion kinase with a phosphorylated activation loop. transferase
216 4k9y:A 0 249 39.4% 2 focal adhesion kinase catalytic domain in complex with 1-[4-( purin-9-yl)-phenyl]-3-(5-tert-butyl-2-p-tolyl-2h-pyrazol-3 transferase/transferase inhibitor
217 1u59:A 0 244 39.3% 2.3 sm.mol STU crystal structure of the zap-70 kinase domain in complex with staurosporine transferase
218 4gu6:A 0 249 39.0% 1.95 sm.mol 10N focal adhesion kinase catalytic domain in complex with n-{3-[ 2-phenyl-1h-pyrrolo[2,3-b]pyridin-4-ylamino)- methyl]-pyri n-methyl-methanesulfonamide transferase/transferase inhibitor
219 2etm:A 0 249 38.2% 2.3 sm.mol 7PY crystal structure of focal adhesion kinase domain complexed with 7h-pyrrolo [2,3-d] pyrimidine derivative transferase
220 4h1j:A 0 250 37.6% 2 crystal structure of pyk2 with the pyrazole 13a transferase/transferase inhibitor
Mapped PDB chain shown with spacefill, all other chains - with wireframe. Structure centered on variant residue.

EGFR_HUMAN/712-968 :
midline :
1m14:A/17-273 :
FKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEF
FKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEF
FKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEF
(Sphere) Residue Colors:
specificity
 
conserved
 
neutral
 
unmapped
 
hetero
 
variant
 

 

 


Label Alpha Carbon




Computational Biology Center | Memorial Sloan Kettering Cancer Center